Schematic Representation and Molecular Properties of Chimeric trans-Sialidases
| Schematic Representation | Name | MW | Sp. Act. | Net Charge | No. of Repeats |
|---|---|---|---|---|---|
| H2N | TSac | 75.9 | 0.56 | −1.7 | — |
| H2N | TS-Ag 1 | 126.6 | 0.48 | −25.7 | 6 |
| H2N | TS-Ag 13 | 113.7 | 0.77 | −13.4 | 56 |
| H2N | TS-Ag 36 | 100.7 | ND | −18.8 | 6 |
| H2N | TS-SAPA | 94.6 | 1.09 | −12.4 | 13 |
| H2N | TS-3R | 78.5 | 0.65 | −3.4 | 3 |
| H2N | TS-8R | 84.2 | 0.61 | −7.5 | 8 |
| H2N | TS-13R | 91.7 | ND | −12.5 | 13 |
| Schematic Representation | Name | MW | Sp. Act. | Net Charge | No. of Repeats |
|---|---|---|---|---|---|
| H2N | TSac | 75.9 | 0.56 | −1.7 | — |
| H2N | TS-Ag 1 | 126.6 | 0.48 | −25.7 | 6 |
| H2N | TS-Ag 13 | 113.7 | 0.77 | −13.4 | 56 |
| H2N | TS-Ag 36 | 100.7 | ND | −18.8 | 6 |
| H2N | TS-SAPA | 94.6 | 1.09 | −12.4 | 13 |
| H2N | TS-3R | 78.5 | 0.65 | −3.4 | 3 |
| H2N | TS-8R | 84.2 | 0.61 | −7.5 | 8 |
| H2N | TS-13R | 91.7 | ND | −12.5 | 13 |
Different motifs present in chimeric trans-sialidases are indicated by boxes of different pattern. From N- to C-terminus: the pTrcHis fusion peptide (), the trans-sialidase domain responsible for the catalytic activity (empty box), and the variable repetitive domain (▨). TS-SAPA and TS-Ag 13 proteins contain an additional nonrepeated stretch of amino acids on their C-termini indicated by ▪. H2N denotes the N-terminus of every protein. MW are indicated in kD and specific activities (Sp. Act.) are indicated in U/nmol. Predicted net charge at pH 7 for each protein is indicated. ND for nondetermined. Hyphen denotes absence of repetitive units in TSac protein. Amino acid sequence of repetitive units are: antigen 1 (SMNARAQELAREKKLADRAFLDQKPEGVPLRELPLDDDSDFVAMEQERRQQLEKDPRRNAKEIAALEE; 68 amino acids), antigen 13 (EPKSA; 5 amino acids), antigen 36 (ALPQEEQEDVGPRHVD PDHFRSTTQDAYRPVDPSAYKR; 38 amino acids), and antigen SAPA (DSSAHSTPSTPA; 12 amino acids).
